Protein Info for AO356_26930 in Pseudomonas fluorescens FW300-N2C3

Annotation: aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 TIGR04350: putative C-S lyase" amino acids 5 to 378 (374 residues), 413.1 bits, see alignment E=5.4e-128 PF00155: Aminotran_1_2" amino acids 32 to 373 (342 residues), 123.7 bits, see alignment E=5.4e-40

Best Hits

KEGG orthology group: K14155, cystathione beta-lyase [EC: 4.4.1.8] (inferred from 93% identity to pba:PSEBR_a2843)

Predicted SEED Role

"putative aminotransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.8

Use Curated BLAST to search for 4.4.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W8Y5 at UniProt or InterPro

Protein Sequence (382 amino acids)

>AO356_26930 aminotransferase (Pseudomonas fluorescens FW300-N2C3)
MTFDFDTVLERHGTGSTKWSRYPADVLPMWVADMDFPAPPVVIDALHKRLEHPMLGYSVA
QDNLRAAIVADLWGKYAWRVEPQQIVFLPGVEPGFNMALRALVEPRQNVVVQVPNYPPLR
HAPGHWQLNKVELPFTPVKGEFHTPLTALREALQGGGALLLSNPHNPLGKVFGREELKAV
ADICLAQDAWIISDEIHAELCFDGRVHIPTASLSPEIAERTITLMSASKAYNIAGLKTSF
AIIQNAKLRERVNNARAGMVDSVNAFGLEATRAAYSEAGPWLEALKAYLQANRDYLVEAV
STRLPGITMTVPQGTYLAWLDCSGLGLDDPQGFFLKEAKVGLSAGLDFADDAGQFVRLNF
GCPRALLEEGLARMERSLKARG