Protein Info for AO356_26875 in Pseudomonas fluorescens FW300-N2C3

Annotation: alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF08240: ADH_N" amino acids 27 to 88 (62 residues), 34.6 bits, see alignment E=2.2e-12 PF00107: ADH_zinc_N" amino acids 156 to 232 (77 residues), 37.7 bits, see alignment E=2.8e-13 PF13602: ADH_zinc_N_2" amino acids 187 to 304 (118 residues), 39.8 bits, see alignment E=1.3e-13

Best Hits

KEGG orthology group: None (inferred from 72% identity to rle:RL2359)

Predicted SEED Role

"FIG00966252: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WP33 at UniProt or InterPro

Protein Sequence (310 amino acids)

>AO356_26875 alcohol dehydrogenase (Pseudomonas fluorescens FW300-N2C3)
MKRIQYHNYGGPQVMKLEAFALASPGQGEVAVKVRFAAINPIDWKLRSGQMKIVTGRSFP
RAMGMDFSGVVMAVGSNVTRFKVGDAVFGLARFKESGALAEAVVTKESLLASKPENVSFE
QAACLGTPGTTAWNGLRDKAGLTAGQRVFINGCSGAVGEACVQIARMVGATITGSCSEET
LGRARQLGVDTVHDYRKTDLSRLPERFDVVYDTAATMALPVGLNLLRKGGVLLDLNPSPG
KFIRSFFDKRLKPVICTPRPEVLDTLAQAAQNGSFRLPVAQVVPLDDAIQLIAAIEGGRK
LRGKALVAMD