Protein Info for AO356_26825 in Pseudomonas fluorescens FW300-N2C3

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 160 to 180 (21 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 3 to 451 (449 residues), 410.4 bits, see alignment E=5.4e-127 PF00672: HAMP" amino acids 178 to 228 (51 residues), 33.7 bits, see alignment 5.8e-12 PF00512: HisKA" amino acids 236 to 301 (66 residues), 54.5 bits, see alignment E=1.5e-18 PF02518: HATPase_c" amino acids 345 to 444 (100 residues), 69.5 bits, see alignment E=5e-23

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 96% identity to pba:PSEBR_a2894)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X1J1 at UniProt or InterPro

Protein Sequence (457 amino acids)

>AO356_26825 histidine kinase (Pseudomonas fluorescens FW300-N2C3)
MKRSIAKRLALMFALAVLLIMSISATLLRCSLKQSLDEQMQNELILRHSVLDPVLAKYDS
PTFWVGLRQKLDGLTPADERVRYWILVDDPAFSYGGAMPDGQDWSTRSDGLFTLDLPERE
RPMMVLLKTIAAMGDRPELRFIVGLDSTPFRKTLDHFTKILILTSALGIGLVALLGYWIA
RFGLGPVRRLSRQANSLPPGDSKQRLDTEALPGELQELAVSFNGALARQEAAWCQLEGFN
ANVAHELRTPLTNLIGQTQVALAHGREVSELQDLLQSNLEELERMGTIVNDMLFLAGAES
GQRATELSDVSLYEEAAKTVEYLEPVLHDKQLSVVIQGDMRVCIDRRLFHRSLANLLQNA
ARYAVPTSTVTVSLVNHGMQVEVSVSNAGEPIDTVHLERLFERFYRADAARTRSDAHHGL
GLSIVRAVASMHGGRVFAHSENGLNTFGFSLMNQAAS