Protein Info for AO356_26570 in Pseudomonas fluorescens FW300-N2C3

Annotation: disulfide bond formation protein DsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF13462: Thioredoxin_4" amino acids 10 to 170 (161 residues), 88.9 bits, see alignment E=4.3e-29 PF01323: DSBA" amino acids 23 to 163 (141 residues), 46.2 bits, see alignment E=4.8e-16

Best Hits

KEGG orthology group: None (inferred from 89% identity to ppf:Pput_1985)

Predicted SEED Role

"Na+/H+ antiporter NhaA type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WNY7 at UniProt or InterPro

Protein Sequence (176 amino acids)

>AO356_26570 disulfide bond formation protein DsbA (Pseudomonas fluorescens FW300-N2C3)
MATLKVPVSDNDHRQGSAHAKVTLVEFGDYECPYCGEAYWMVKELQKHFRDDLQFVFRNF
PLTTAHPHAMGAAVTAEYAGSRGFFWEAHDELYENQERLGLPLFRAIALKHGLSSEELVL
AMQDGTYLPKIQSDFNGGVRSGVNGTPAFYIDGLRYDGVPEFAEMSQMIELSLVRG