Protein Info for AO356_26185 in Pseudomonas fluorescens FW300-N2C3

Annotation: peptidoglycan-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF20142: Scaffold" amino acids 55 to 180 (126 residues), 71.6 bits, see alignment E=1.7e-23 PF01471: PG_binding_1" amino acids 210 to 265 (56 residues), 34.4 bits, see alignment 3.1e-12 PF03734: YkuD" amino acids 296 to 448 (153 residues), 75.6 bits, see alignment E=1e-24

Best Hits

KEGG orthology group: None (inferred from 91% identity to pba:PSEBR_a2969)

Predicted SEED Role

"cell wall degradation protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WEK2 at UniProt or InterPro

Protein Sequence (520 amino acids)

>AO356_26185 peptidoglycan-binding protein (Pseudomonas fluorescens FW300-N2C3)
LFKKSACYLSLLLLTAPLVATAEDSDPALVQTTLAQLAAACPDVAVGADFPTLLDLQAFY
QQNAGQEVWSDDERRGALQVQLQQLADDGLDPARYGLPGEGVTQVPHCADIAISRRYLQA
LHDLRFGYLPQDRLEPVWKANPPPQDHPAVVLAIAGLGLQNLADAFEQARPNLDLYRNLR
GLYARLRQQPLAEWQAVPGGPLLQPDKQDARVPALAQRLFNEGYLSTPPQVSDEHYSPML
VEAMKSFQAQHSLQADGVVGPWTVTELNISPAMRREQLRINLERMRWLAQDVETDSVLVN
VAAAQLTVYQGGAPVWQTRTQVGRAQRQTPLLKSHVTRLTLNPTWTIPPTIMREDKLPEI
RRDPEFLSRHNLRILDGDGLPLLAENIDWEHPGNLMLRQDPGPKNPLGKMAIRFPNPFSV
YLHDTPSQALFSKGPRAFSSGCVRIEQVMHLRDLLVSPAERARTDTLLASESTHEFRLAR
PVPILLGYWTAQADSQGQAVYIPDIYGRDATLSAARGRAL