Protein Info for AO356_26025 in Pseudomonas fluorescens FW300-N2C3

Annotation: glycogen synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 PF08323: Glyco_transf_5" amino acids 46 to 280 (235 residues), 243.4 bits, see alignment E=7.2e-76 TIGR02095: glycogen/starch synthase, ADP-glucose type" amino acids 46 to 512 (467 residues), 477.6 bits, see alignment E=2e-147 PF13439: Glyco_transf_4" amino acids 161 to 267 (107 residues), 29 bits, see alignment E=2.5e-10 PF00534: Glycos_transf_1" amino acids 337 to 475 (139 residues), 57.8 bits, see alignment E=2.7e-19 PF13692: Glyco_trans_1_4" amino acids 338 to 474 (137 residues), 43.2 bits, see alignment E=1.2e-14

Best Hits

Swiss-Prot: 86% identical to GLGA_PSEF5: Glycogen synthase (glgA) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K00703, starch synthase [EC: 2.4.1.21] (inferred from 99% identity to pba:PSEBR_a3006)

Predicted SEED Role

"Glycogen synthase, ADP-glucose transglucosylase (EC 2.4.1.21)" in subsystem Glycogen metabolism (EC 2.4.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X4Z5 at UniProt or InterPro

Protein Sequence (523 amino acids)

>AO356_26025 glycogen synthase (Pseudomonas fluorescens FW300-N2C3)
MISAALEPQQVRSQLPPAAESPTAPVLATGGKALLPVVRQNPNRKKVLFVTSEIADLVKT
GGLGDVSSALPRAMAGLHDVRVLIPGYPQVMNSGNPIHIVGELGGHAALPPCKIGRMDMA
DGLVIYVLICPELFAREGSPYGANNGRDWPDNHIRFARLGLAAADIAANLAQIHWCPDLV
HAHDWPAGLAPAYMHWRGQRTPTLFTIHNLAYQGVVSLASCPELGIPEHALQQEGMEFYG
KLSFLKAGMAYSSHITTVSATYAQEITTPAFGCGLDGFLAAKTQQGLLSGIPNGIDESWD
SATDTHLFRQFAMGDWEGKAVNASHVRELFGLDDSPGPLFAVVSRLVYQKGLDLTEAVAE
FIVESGGQIAIIGRGEPEEEQAMRELALRFPGRIGVRIGFNETDARRMFAGSDFLLMPSR
YEPCGLSQMYAQRFGSLPVARNTGGLADTIEDGVTGFLFDESTVESYQQALSRAFKVFEF
PDLLNAMRCRAMSAPFNWCQAVEPYAELYEQLVAKSLGKSARQ