Protein Info for AO356_25700 in Pseudomonas fluorescens FW300-N2C3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 28 to 47 (20 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 6 to 299 (294 residues), 64.6 bits, see alignment E=4.2e-22

Best Hits

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a2766)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WZV3 at UniProt or InterPro

Protein Sequence (331 amino acids)

>AO356_25700 hypothetical protein (Pseudomonas fluorescens FW300-N2C3)
VGVYRLLLAMLVAVSHMGVTFMGLNPGVVAVVSFLIISGFVMTSLIERTYNTPGQIGLFY
IDRLLRLYPQFLVYFVMSCAVIHFLLPGTPQAAALTLENIATSLPIVPLGFYMFGITVPE
ILPPGWSLGLEMCFYLLIPFLILYKTRGVAFAVSVTVFMVASLGYLDTDIYGYRLLPGVL
FIFLCGSYLYRAQAKGLWIVSITLFVAALMFLAIVVGIIPRRPFNAEVTLGIALGLPAVF
LLGRMKHHRLDEFLGNISYGVFLNHFVVMYVLRAFWPVEYSALIITAVLVLSFALSGVSY
YGVERPALKLRHALRAGVKYGATAPVGSTVA