Protein Info for AO356_25640 in Pseudomonas fluorescens FW300-N2C3

Annotation: L-dehydroascorbate transporter large permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 7 to 35 (29 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 92 to 129 (38 residues), see Phobius details amino acids 138 to 163 (26 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 240 to 256 (17 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 314 to 343 (30 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 396 to 418 (23 residues), see Phobius details PF06808: DctM" amino acids 7 to 416 (410 residues), 424 bits, see alignment E=3e-131 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 418 (402 residues), 481.8 bits, see alignment E=7.4e-149

Best Hits

Swiss-Prot: 59% identical to YIAN_ECOLI: 2,3-diketo-L-gulonate TRAP transporter large permease protein YiaN (yiaN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to pba:PSEBR_a2754)

MetaCyc: 59% identical to 2,3-diketo-L-gulonate:Na+ symporter - membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-235

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H2Y8 at UniProt or InterPro

Protein Sequence (426 amino acids)

>AO356_25640 L-dehydroascorbate transporter large permease subunit (Pseudomonas fluorescens FW300-N2C3)
MTLVIFLGSLIGSMALGMPIAFALLVVSVALMVYLDLFDAQIIAQNLLNGADSFPLMAVP
FFMLAGEIMNVGGLSKRIVNIAMALVGHKRGGLGYVAIIASCLLASLSGSAVADAAALAA
LLVPMMVLAGHNRGRSAGLIAAGSIIAPVIPPSIGFIVFGVASGVSISKLFLAGIVPGLM
LGASLAVAWWYISRSENVETPPKRSRAEVLRTLLDGSWAMGLPLIIILGLKFGIFTPTEA
AVVAAVYSLFVSLVIYREMKVSQLYEVILSSAKTTSVVMLLVAAAMVSSWLVTIADLPGQ
LAELLAPFMDNQTVLLLVMMVLIILVGTVMDMTPTILILTPVLMPAVIQAGIDPVYFGVL
FLINTAIGLITPPVGTVLNVVCGVAKLDFEEIVRGVWPFMFAQFVVLFLLVLFPQLVLGP
LKFFTG