Protein Info for AO356_25250 in Pseudomonas fluorescens FW300-N2C3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 63 to 88 (26 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 322 to 347 (26 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 399 to 417 (19 residues), see Phobius details amino acids 430 to 450 (21 residues), see Phobius details PF12801: Fer4_5" amino acids 63 to 107 (45 residues), 41.4 bits, see alignment 5.4e-15 amino acids 148 to 182 (35 residues), 24 bits, see alignment 1.6e-09

Best Hits

KEGG orthology group: None (inferred from 90% identity to pba:PSEBR_a2686)

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W880 at UniProt or InterPro

Protein Sequence (455 amino acids)

>AO356_25250 hypothetical protein (Pseudomonas fluorescens FW300-N2C3)
MPHLNPWLQRLGDGMRRHGATIRAVQWAVVLFYAVLLVIPALLPLPSSQAHLFDNLTLLA
QFLFWGLWWPFVLLSIVLFGRLWCGVLCPEGALSEWASRYGKGLGVPRSVRWAGWPTLAF
CLTTIYGQLISVYDYAQAALLILGGSTVAAVIVGLLFARGKRVWCRYLCPVSGVFALLAR
LAPMHFQVDEQRWLENPAPRRPAPNCAPLLDIRRMRGATDCHACGRCSGQRDAVRLIARS
SNQEILQSTPTTLSPWDVRLLLFGVIGLAMGAFQWTVSPWFITLKQALAQWLVAHDRFWP
LQDNAPWWLLTHYPQLNDSFSWLDGFCIVAYLGMSALLLGTSLMLLMRLAARLAGDCAEY
LPLAVTLTPLGGAGLFLGLSATTVKLLRYEGLLLEWVQPARAGLLVAAIAWSLWLGWKRL
EQTSASPVQRLPAMACLIVASGLVGYGWWLQFWGW