Protein Info for AO356_25035 in Pseudomonas fluorescens FW300-N2C3

Annotation: heme d1 biosynthesis radical SAM protein NirJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 TIGR04051: heme d1 biosynthesis radical SAM protein NirJ" amino acids 29 to 380 (352 residues), 599.2 bits, see alignment E=1.1e-184 PF04055: Radical_SAM" amino acids 34 to 189 (156 residues), 91.8 bits, see alignment E=5.8e-30 PF13353: Fer4_12" amino acids 36 to 138 (103 residues), 33.5 bits, see alignment E=5.2e-12

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a3179)

MetaCyc: 40% identical to Fe-coproporphyrin synthase (Methanosarcina barkeri)
1.3.99.-

Predicted SEED Role

"Heme d1 biosynthesis protein NirJ" in subsystem Dissimilatory nitrite reductase or Heme biosynthesis orphans

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WE16 at UniProt or InterPro

Protein Sequence (392 amino acids)

>AO356_25035 heme d1 biosynthesis radical SAM protein NirJ (Pseudomonas fluorescens FW300-N2C3)
MLRISHYLRALAGQCPAPRVAPPGKHRPPVVIWNLLRRCNLTCKHCYATSADSVFRDELD
TAAALKVIDDLHDAGVRVLILSGGEPLLRDDLFQLSAYARSKGFFLALSTNGTLIDASNI
QQIAAANFDYVGISIDGLEATHDEFRQLKGSFASSMAAIRLCREQGIRVGLRTTLTQHNH
AQLPRLLDLMDEYDVQKFYLSHLNYSGRGKRSRKLDAHQQMGREAMTLIFERAWHDIEQG
RDSDFVSGNNDADAILLLQWVSRRMPQHYAALEQMLRAWGGNASGSGIANIDNTGEVHPD
TYWWQHSVGNVRQTPFKTLWSDRPDTLLLKLREHPRAVGGRCGQCRWLDICNGNTRTRAW
ADGDLWGQDPGCHLNDDEIGLHAIPSVAMPCA