Protein Info for AO356_24970 in Pseudomonas fluorescens FW300-N2C3

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 289 to 315 (27 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 249 (239 residues), 64.2 bits, see alignment E=5.4e-22

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a3194)

Predicted SEED Role

"Probable MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X0R3 at UniProt or InterPro

Protein Sequence (388 amino acids)

>AO356_24970 MFS transporter (Pseudomonas fluorescens FW300-N2C3)
LNPQHRHAWGLAFGLCLITLAVNLQAPLYTTYAQLSGSGAGATAVAFSGYVLGVLPVLLA
FGGLADRVGRKPLILVALGLSMLATLVTLLWPSLVALGVARLMMGVGTGLASATSTAYMT
ELMATRDTRSPANRVTASTSLGFGLGAALTSLFLFVHPSATPGSFWLQLLLAALAIVVVW
RLPDPALKIKDARLLRLPLFPAGSLPYSFSMLLAWATSGLVIAILPSVLATHDLQRWSGL
STFTVISCGLLFQPWVRRMSPARATGLGLLILPVSYALLAWGASAGSLLAVLLGALGASS
ACYGFLYLGGLSAVTAMAGAEKARVSAGFFLFAYVGFSIPVVVTGLLADHFGADVALIVF
GLALLAGVSVTGWRIVRTEAYVSHLSHG