Protein Info for AO356_24960 in Pseudomonas fluorescens FW300-N2C3

Annotation: hydroxyproline-2-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF05544: Pro_racemase" amino acids 6 to 309 (304 residues), 347.8 bits, see alignment E=3e-108

Best Hits

Swiss-Prot: 82% identical to 4HYPE_PSEAE: 4-hydroxyproline 2-epimerase (PA1268) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K12658, 4-hydroxyproline epimerase [EC: 5.1.1.8] (inferred from 99% identity to pba:PSEBR_a3196)

MetaCyc: 82% identical to 4-hydroxyproline epimerase subunit (Pseudomonas aeruginosa)
4-hydroxyproline epimerase. [EC: 5.1.1.8]

Predicted SEED Role

"4-hydroxyproline epimerase (EC 5.1.1.8)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 5.1.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.8

Use Curated BLAST to search for 5.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WWQ4 at UniProt or InterPro

Protein Sequence (310 amino acids)

>AO356_24960 hydroxyproline-2-epimerase (Pseudomonas fluorescens FW300-N2C3)
MKRITVIDSHTGGEPTRLVTDGFPDLGQGSMAERKQRLAAEHDTWRTACVLEPRGSDVLV
GALLCEPVDPSACAGVIFFNNSGYLGMCGHGTIGLVASLAHLGRIGPGVHSIETPVGTVQ
ATLHEDRSVSVRNVPAYRYRKALALEVPGIGQVVGDVAWGGNWFFLIAEHGQRVAGDNLD
ALTAYTYAVQQALEQQGFRGEDGGLIDHIELFADDPQADSRNFVLCPGKAYDRSPCGTGT
SAKLACLAADGKLQPGQIWRQASVIGSEFEGSYEHSGERIVPTIRGRAYISAETTLIIET
DDPFAWGIRP