Protein Info for AO356_24665 in Pseudomonas fluorescens FW300-N2C3

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF20030: bpMoxR" amino acids 12 to 185 (174 residues), 61.1 bits, see alignment E=2.1e-20 PF00493: MCM" amino acids 28 to 150 (123 residues), 23.6 bits, see alignment E=6.4e-09 PF07728: AAA_5" amino acids 37 to 165 (129 residues), 42.9 bits, see alignment E=1.3e-14 PF07726: AAA_3" amino acids 37 to 167 (131 residues), 213.8 bits, see alignment E=1.7e-67 PF17863: AAA_lid_2" amino acids 247 to 312 (66 residues), 80.5 bits, see alignment E=1.6e-26

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 97% identity to psb:Psyr_1721)

Predicted SEED Role

"MoxR-like ATPase in aerotolerance operon"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0D9AXZ3 at UniProt or InterPro

Protein Sequence (319 amino acids)

>AO356_24665 AAA family ATPase (Pseudomonas fluorescens FW300-N2C3)
MEHREALLALRTFLSTQILGQEKLIERLLIALLADGHMLVEGAPGLAKTKAIKELAEGIE
AQFHRIQFTPDLLPADITGTEIYRPETGSFVFQQGPIFHNLVLADEINRAPAKVQSALLE
AMAERQVSVGRSTYELSPLFLVMATQNPIEQEGTYPLPEAQLDRFLMHVKIGFPDAAVER
RILQQARGEALNGETKPERRVSQQAIFSARKEILGLYMADAVEEYLVQLIMATRNPAKFD
PEMAEWIAYGASPRGSIALDRCARAHAWLAGRDFVSPEDIQAVLFDVLRHRIILSFEAEA
AGIDQDRVVQRILDVVAVA