Protein Info for AO356_24200 in Pseudomonas fluorescens FW300-N2C3

Annotation: dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 163 to 178 (16 residues), see Phobius details PF08240: ADH_N" amino acids 24 to 129 (106 residues), 113 bits, see alignment E=1.6e-36 PF16912: Glu_dehyd_C" amino acids 150 to 319 (170 residues), 37.3 bits, see alignment E=5.4e-13 PF01262: AlaDh_PNT_C" amino acids 158 to 205 (48 residues), 23 bits, see alignment 1.2e-08 PF00107: ADH_zinc_N" amino acids 169 to 294 (126 residues), 78.5 bits, see alignment E=1.1e-25

Best Hits

Swiss-Prot: 31% identical to DHSO_BACHD: Sorbitol dehydrogenase (gutB) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: None (inferred from 93% identity to pba:PSEBR_a2378)

Predicted SEED Role

"Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H2V4 at UniProt or InterPro

Protein Sequence (336 amino acids)

>AO356_24200 dehydrogenase (Pseudomonas fluorescens FW300-N2C3)
MLTVICNEPGSLTAIEREHPLRKPGEILIRVKRVGVCGTDLHIFTGNQPYLEYPRVMGHE
FSGVVEGSDEASDLAVGDVVYVMPYLSCGTCIACRQGKTNCCTAIQVLGVHCDGAFTQYL
SVPHAFVHKAVGVSLDQAAMIEFLSIGAHAVRRSNIQAQKHALVVGTGPIGMAAAIFASL
RGAKVTVLDTREDRLSFCKQHLNIHAAVQIGEGDKQALAELTEGDFFDVVFDATGNARAM
ERGFEFIAHGGTYVMISVVRDSITFSDPEFHKREATLMGSRNATQEDFRHVEQCLRDGLI
PDAALNTHRLTLGDVPHSFATLLDPTQGVVKAIIEC