Protein Info for AO356_24160 in Pseudomonas fluorescens FW300-N2C3

Annotation: formate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF01257: 2Fe-2S_thioredx" amino acids 12 to 154 (143 residues), 134.4 bits, see alignment E=1.4e-43

Best Hits

KEGG orthology group: K00127, formate dehydrogenase, gamma subunit [EC: 1.2.1.2] (inferred from 99% identity to pba:PSEBR_a2581)

MetaCyc: 33% identical to hydrogenase (NAD+, ferredoxin) gamma subunit (Gottschalkia acidurici)

Predicted SEED Role

"NAD-dependent formate dehydrogenase gamma subunit" in subsystem Formate hydrogenase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H2V3 at UniProt or InterPro

Protein Sequence (160 amino acids)

>AO356_24160 formate dehydrogenase (Pseudomonas fluorescens FW300-N2C3)
MPDETLHLPLIHSVLAREKDTPGALLPILHAIQAGCGYVPDSAVPEIAHALNLSLAEVRG
VISFYHDFRTTPPARHTLRLCRAESCKSMGAEALAAQLREQLALDDHGTSADGSISLRPV
YCLGACVCSPALELDGELHARITPERLRQLVNDCMEEGAC