Protein Info for AO356_23495 in Pseudomonas fluorescens FW300-N2C3

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 5 to 162 (158 residues), 40.8 bits, see alignment E=6.5e-14 PF01370: Epimerase" amino acids 5 to 231 (227 residues), 93 bits, see alignment E=9.4e-30 PF16363: GDP_Man_Dehyd" amino acids 5 to 158 (154 residues), 34.8 bits, see alignment E=5.8e-12 PF02719: Polysacc_synt_2" amino acids 5 to 118 (114 residues), 33.9 bits, see alignment E=9.3e-12 PF05368: NmrA" amino acids 6 to 117 (112 residues), 55.9 bits, see alignment E=1.9e-18 PF07993: NAD_binding_4" amino acids 6 to 161 (156 residues), 46.9 bits, see alignment E=9.5e-16 PF01073: 3Beta_HSD" amino acids 6 to 179 (174 residues), 81.1 bits, see alignment E=3.3e-26 PF13460: NAD_binding_10" amino acids 8 to 156 (149 residues), 72.6 bits, see alignment E=1.8e-23

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a2456)

Predicted SEED Role

"Dihydroflavonol-4-reductase (EC 1.1.1.219)" in subsystem Biflavanoid biosynthesis or Tannin biosynthesis (EC 1.1.1.219)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.219

Use Curated BLAST to search for 1.1.1.219

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W7J5 at UniProt or InterPro

Protein Sequence (337 amino acids)

>AO356_23495 oxidoreductase (Pseudomonas fluorescens FW300-N2C3)
MEYAFVTGATGLLGNNIVRALLKRNIKVKALVRSAEKAKKQFASLPVEWVEGDMLNVDAF
SHALQGCDALFHTAAYFRDSYKGGKHWQKLYDTNVTGTERLLQAAYAAGIRRAVHTSSIA
VLKGNKDQVIDETMSRSEQEADDYYLSKILSEQKVQQFLSQHPDMFIAMVLPGWMFGPGD
IGPTSSGQFLLDFVGQKLPGVLPGSFSVVDARDVAEHQIAAITRGRSGERYLAAGNHMDM
KSIFQALSSVSGVKAPERKVPLFMLRIIALIYEGYYRITKKPVLISTSTVKLMAQEQGRT
HFSHNKSSRELECQFRPVAETLTDTLDWYRNNNYTDA