Protein Info for AO356_23340 in Pseudomonas fluorescens FW300-N2C3

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 675 PF08495: FIST" amino acids 40 to 250 (211 residues), 92.2 bits, see alignment E=6e-30 PF10442: FIST_C" amino acids 265 to 389 (125 residues), 60.5 bits, see alignment E=2.9e-20 PF00015: MCPsignal" amino acids 523 to 672 (150 residues), 103.2 bits, see alignment E=2.2e-33

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a2398)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X1Y6 at UniProt or InterPro

Protein Sequence (675 amino acids)

>AO356_23340 chemotaxis protein (Pseudomonas fluorescens FW300-N2C3)
MNLSNLFNKARARTQGAVSVACTLSELDQALASVRITPVLIAGFVSPHLDIDRVAAKVKQ
RFPQSAISLCTTSGELCNGANALYCQTGETWDRVVLQLFDASVIASAEVVMVPLECEDIR
GGGKRLAMRERIARLVSNIKQAQVSTPIDHRDTLAYVVFDGLSASESFFMEALYESGRFP
CLFVGGSAGGKADFKKTLISDGQRSYQNHAQIVFLKTAADVRFGVFKSQNFQPAGLTFSV
LTASVEDRTIDQVIDSRGNIKSMVQALCEAFECSAQALEKKLADYSFAIRVGDELFVRSI
ARIDHQQQIIQLFCDVAPGEELVMVKRTPLREATRLDYEKFLKGKGGRPVAAILNDCILR
RLNNSSDLGSMAGIFGDVPLAGFSTFGEILGLNLNQTLTAIFFFRVTKGAGFVDEYVDHF
ITHYGEFKAFFLRRQIKKLAGLNHVVVKQIMAFKMNDFSSALDTRGLDQTILPVFDGLTD
LGQVLAQASQHQASMATQIKHYSGELHLSMDDLTGTIDRQNSVAEQAGTTVEQLATQAGE
AVVGARALASSSLRIQSIVQVIQQIAGQTNLLALNAAIEAARAGEMGRGFAVVADEVRKL
AEITRKNAAEIGVDIDLLSTEIQGVAQQIEDQSVAVSALREMLDALEDSSRTTEGTAQRT
KAIADTLTGLTHANA