Protein Info for AO356_23210 in Pseudomonas fluorescens FW300-N2C3

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 86 to 110 (25 residues), see Phobius details amino acids 117 to 163 (47 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 59 to 326 (268 residues), 144 bits, see alignment E=2.6e-46

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 99% identity to pba:PSEBR_a3346)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X2Y7 at UniProt or InterPro

Protein Sequence (340 amino acids)

>AO356_23210 ABC transporter (Pseudomonas fluorescens FW300-N2C3)
MNAILENKPAAAPTRSRRRLPTELSIFLVLIGIGLVFEMFGWIMRDQSFLMNSQRLVLMI
LQVSIIGLLAIGVTQVIITTGIDLSSGSVLALSAMIAASLAQTSDFARAVFPSLTDLPVW
IPVVAGLGVGLLAGAINGSIIAITGIPPFIATLGMMVSARGLARYYTEGQPVSMLSDSYT
AIGHGAMPVIIFLVVAVIFHIALRYTKYGKYTYAIGGNMQAARTSGINVKRHLVIVYSIA
GLLAGLAGVVASARAATGQAGMGMSYELDAIAAAVIGGTSLAGGVGRITGTVIGALILGV
MASGFTFVGVDAYIQDIIKGLIIVVAVVIDQYRNKRKLKR