Protein Info for AO356_23090 in Pseudomonas fluorescens FW300-N2C3

Annotation: dihydropyrimidine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14691: Fer4_20
  • amino acids 21 to 127 (107 residues), 117.4 bits, E=1.1e-37
• PF07992: Pyr_redox_2
  • amino acids 142 to 437 (296 residues), 121.5 bits, E=1.9e-38
• PF03486: HI0933_like
  • amino acids 142 to 176 (35 residues), 23.7 bits, 7.8e-09
• PF00890: FAD_binding_2
  • amino acids 143 to 177 (35 residues), 23.4 bits, 1.3e-08
• PF13450: NAD_binding_8
  • amino acids 145 to 177 (33 residues), 36.4 bits, see alignment (E = 2.1e-12)
• PF01593: Amino_oxidase
  • amino acids 151 to 177 (27 residues), 21.1 bits, see alignment (E = 6.9e-08)

Best Hits

KEGG orthology group: K00266, glutamate synthase (NADPH/NADH) small chain [EC: 1.4.1.13 1.4.1.14] (inferred from 96% identity to pba:PSEBR_a3368)

Predicted SEED Role

"Pyridine nucleotide-disulphide oxidoreductase associated with reductive pyrimidine catabolism" in subsystem Pyrimidine utilization

MetaCyc Pathways

• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of ammonia assimilation (plants) (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• ammonia assimilation cycle I (2/2 steps found)
• L-glutamate biosynthesis IV (1/1 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13, 1.4.1.14

Use Curated BLAST to search for 1.4.1.13 or 1.4.1.14

Sequence Analysis Tools

See A0A0N7H3C1 at UniProt or InterPro

Protein Sequence (455 amino acids)

>AO356_23090 dihydropyrimidine dehydrogenase (Pseudomonas fluorescens FW300-N2C3)
MIQPLSHLPHSQEDPATLAARFSDLAPPLNARQAHLEASRCLYCYDAPCVNACPSEIDIP
SFIRNIHQDNVQGAAQKILSANILGGSCARVCPTEVLCQQACVRNNAHECAPVLIGSLQR
YAVDNAHFSEHPFKRAATTGKRIAVVGAGPAGLACAHRSAMHGHDVVIFEARDKAGGLNE
YGIAKYKLVDDYAQRELDFLLDIGGIEIRHGQKLGENLSLSDLHQQFDAVFLGLGLAASK
QLGLSDEQAPGVLAATEYIRELRQADDLSQLPLADRCIVLGAGNTAIDMAVQMARLGARD
VSLVYRRGLEDMGATLHEQDIAKANQVRLLTWAQPQQVLLDDAGHVRGMRFSRTHLENGR
LVIGAETFDLAADAVFKAIGQAFDDHALVDPLARELKRQDGRILVDEHLRTSIPGVYAGG
DCTSLDQDLTVQAVQHGKLAAEAINAQLMLNVEAA