Protein Info for AO356_23050 in Pseudomonas fluorescens FW300-N2C3

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details PF04290: DctQ" amino acids 28 to 153 (126 residues), 85.6 bits, see alignment E=1.4e-28

Best Hits

KEGG orthology group: None (inferred from 82% identity to pba:PSEBR_a3374)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X3Q5 at UniProt or InterPro

Protein Sequence (175 amino acids)

>AO356_23050 C4-dicarboxylate ABC transporter (Pseudomonas fluorescens FW300-N2C3)
MKNLLLRINDKIYMTCIWVAGLSVLAISLMIPWGVFARYVLGSGSSWPEPTAILLMMVFT
FIGAAASYRAGAHMAVAMLTDRMPPHLKSAASIFSQLLMALICIFMTVWGFKLCMSTWNQ
FMASLPGLRVGVTYLPIPLGGLLTLVFVLEKLLLGDQSKRRVVQFDLVEESEGAA