Protein Info for AO356_23045 in Pseudomonas fluorescens FW300-N2C3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 44 to 68 (25 residues), see Phobius details amino acids 77 to 106 (30 residues), see Phobius details amino acids 168 to 193 (26 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 313 to 330 (18 residues), see Phobius details amino acids 336 to 353 (18 residues), see Phobius details amino acids 359 to 385 (27 residues), see Phobius details amino acids 397 to 421 (25 residues), see Phobius details PF06808: DctM" amino acids 7 to 417 (411 residues), 395.6 bits, see alignment E=1.3e-122 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 422 (406 residues), 424.8 bits, see alignment E=1.5e-131

Best Hits

Swiss-Prot: 46% identical to YGIK_SALTY: Uncharacterized protein YgiK (ygiK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 96% identity to pfo:Pfl01_3456)

MetaCyc: 38% identical to 2,3-diketo-L-gulonate:Na+ symporter - membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-235

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WBH4 at UniProt or InterPro

Protein Sequence (426 amino acids)

>AO356_23045 hypothetical protein (Pseudomonas fluorescens FW300-N2C3)
MDALILLGSFIVLILIGMPVAYALGAAALIGAWWIDIPFQAVMIQVAGGVNKFSLLAIPF
FVLAGAIMAEGGMSRRLVACAGVLVGFVRGGLSLVNIVASTFFGAISGSSVADTASVGSV
LIPEMERKGYPRDFSTAVTVSGSVQALLTPPSHNSVLYSLAAGGTVSIASLFMAGIVPGL
LMSACLMVLCLIFAKKRNYPKGEVIPMRQALKIVGEALWGLMAMVIILGGILSGIFTATE
SAAIAVLWSFFVTMFIYRDYKWRELPKLMHRTVRTISIVMILIGFAASFGYIMTLMQIPA
KITTMFLTLSDNRYVILMCINVMLLLLGTVMDMAPLILILTPILMPVIVGIGVDPVQFGM
IMLVNLGIGLITPPVGAVLFVGSAIGKVSIESTVKALLPFYAVLFLVLMLVTYVPALSLW
LPHLVL