Protein Info for AO356_22965 in Pseudomonas fluorescens FW300-N2C3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 41 to 59 (19 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 189 to 212 (24 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details PF00892: EamA" amino acids 15 to 143 (129 residues), 47.4 bits, see alignment E=1.1e-16 amino acids 156 to 291 (136 residues), 62.6 bits, see alignment E=2.2e-21

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a3383)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H2S5 at UniProt or InterPro

Protein Sequence (309 amino acids)

>AO356_22965 hypothetical protein (Pseudomonas fluorescens FW300-N2C3)
MTTRRALDGQVSALMTGLCAIWGFQQVAIKASAADMAPMLQLGVRSAIAAVLVWLLVLAR
GERLSLADGSWRPGLLVGLLFALEFVMVGEGLRHTTASHMVIFLYTAPMFAALGLHWKLP
SERLKPAQWLGIAVAFGGIVVAFSGGSGAANGSSLLGDGMGLLAGALWGATTVTVRCSRL
TDVPASQTLLYQLVGAGVLLIGMSVALAQTTINPTPQLIASLAFQVLLVSFASFLIWFSL
LRRYLASQLGVLSFMTPLFGIGFGVWLLDEPLEPNFIVGAVLVLGGILLVSGYGWFHQRW
GRWLVLRRG