Protein Info for AO356_22925 in Pseudomonas fluorescens FW300-N2C3

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 692 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 42 to 66 (25 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 104 to 128 (25 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details PF03707: MHYT" amino acids 52 to 109 (58 residues), 79.6 bits, see alignment 2.1e-26 amino acids 115 to 170 (56 residues), 70.4 bits, see alignment 1.5e-23 amino acids 182 to 243 (62 residues), 26.2 bits, see alignment 9.6e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 259 to 420 (162 residues), 143.4 bits, see alignment E=2.7e-46 PF00990: GGDEF" amino acids 262 to 417 (156 residues), 150.8 bits, see alignment E=4.5e-48 PF00563: EAL" amino acids 438 to 673 (236 residues), 251.1 bits, see alignment E=1.5e-78

Best Hits

Swiss-Prot: 65% identical to Y1727_PSEAE: Uncharacterized signaling protein PA1727 (PA1727) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a3392)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H2S4 at UniProt or InterPro

Protein Sequence (692 amino acids)

>AO356_22925 histidine kinase (Pseudomonas fluorescens FW300-N2C3)
MLIGSYSPALVSISLFVAVLASYTALDLAGRIATAQGRAAHWWMTGGALAMGVGIWSMHF
IGMLAFTLPVELGYDISITALSLLTAILSSGFALWLVSQPRLPAWQLAFGALIMGAGISA
MHYTGMAALRMQPGIDYDPTLFGASLVIAVGASAAALWIAFRLRQNTPHVRLARAGAAVV
MGIAIVGMHYTGMAGARFSEGSFCGSLDGLSGKGLDNLVLITTLAVLAIALLTSILDARL
EARTAELAQSLTRANRELTQLALHDPLTELPNRVLLADRIDQAMHRVQEQGGCFALMFID
LDGFKPVNDAFGHHMGDLLLRDVALRLREDLRSQDTLARIGGDEFVLLVQLAEPDDALRL
AARQVGLIGRTFRVSEHDLQISASVGIALYPGNGQSAEELLMNADAAMYHAKGAGKNGYS
FFDASMNSNARKQLQLLQDLRMAVEQRQFSLHYQPKFDAANGRPVGAEALLRWTHPTQGL
LMPDTFIDLAEKTGLIIPIGEWVLNEACRQMREWYVLGYTDWRIAVNLSALQFCHTGLVQ
SVAKALETHKLPANSLTLEITETTAMSDADASMTVLQLLSDMGVDLSIDDFGTGYSSLMY
LKRLPANELKIDRGFVRDLEHDSDDAAIVSAIVALGQALGLRIVAEGVETDVQQDFLTQL
GCDSLQGYLLGHPLPAERFLQEIRQAKAVAIA