Protein Info for AO356_22625 in Pseudomonas fluorescens FW300-N2C3

Annotation: nitrate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 PF00005: ABC_tran" amino acids 30 to 168 (139 residues), 106.5 bits, see alignment E=1.8e-34 PF09821: AAA_assoc_C" amino acids 305 to 422 (118 residues), 126.5 bits, see alignment E=8.8e-41

Best Hits

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 97% identity to pba:PSEBR_a3449)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WVP8 at UniProt or InterPro

Protein Sequence (434 amino acids)

>AO356_22625 nitrate ABC transporter ATP-binding protein (Pseudomonas fluorescens FW300-N2C3)
MQVIDKRCLVDVQQIGHVYGTAGGAERRVLDNVCMRLDEGEIVGLLGRSGSGKSTLLRSI
AGLISPTTGVVDFPPNAQGLASSVRMVFQSFALFPWLTVLQNVEVGLEALGVAAPERRRR
ALGAIDMIGLDGFESAFPKELSGGMRQRVGLARALVVNPDVLLMDEPFSALDVLTAETLR
TDLLELWREGRMPIRSILMVTHNIEEAVLMCDRILIFSSNPGRVMSEIAVDLSQPRNRAD
PAFQALVEHIYVQMAGGANVGSARQETFAGSGVGMVLPSISSNALAGLIEAVQDQPFAGQ
ADLRELADALRYTASDLLPVAEVLQLLRLADLQDGHITLLPAGLRYAESAVDERKHLFAR
HLLKYVPLVGHVRRVLDDRPTRTAPARRFRDQLEDFMSEHDAAITLDCVTQWGRYAELFA
YDEVADQFSLDNPS