Protein Info for AO356_22525 in Pseudomonas fluorescens FW300-N2C3

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 8 to 187 (180 residues), 168 bits, E=2.8e-53
• PF08659: KR
  • amino acids 11 to 164 (154 residues), 43.9 bits, E=3.9e-15
• PF13561: adh_short_C2
  • amino acids 17 to 246 (230 residues), 183.6 bits, E=7.2e-58

Best Hits

Swiss-Prot: 58% identical to YKVO_BACSU: Uncharacterized oxidoreductase YkvO (ykvO) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 83% identity to bug:BC1001_0715)

MetaCyc: 31% identical to 3-hydroxykynurenate reductase/dehydratase (Streptomyces sp. SNA15896)
1.17.1.-

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• biotin biosynthesis I (13/15 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• stearate biosynthesis IV (4/6 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• 3-hydroxyquinaldate biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (20/205 steps found)
• superpathway of mycolate biosynthesis (21/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

See A0A0N7H2R5 at UniProt or InterPro

Protein Sequence (250 amino acids)

>AO356_22525 oxidoreductase (Pseudomonas fluorescens FW300-N2C3)
MTNKLEGKIALVTGGSTGIGLATAKRFAQEGAHVYITGRRQAELDAAVAAVGNATGVRVD
SADLDQLDALYRQIGATHGRIDVLFANAGGGSMLPLGDITEQQYDDTFNRNVKGVLFTVQ
KALPLLAQKASVILTGSTAGSSGTAAFSVYAASKAAVRSFARNWILDLKDRQVRINTISP
GATRTPGLVELAGPDAAQQQGLLDYMASLIPMGRVGEADEIASAALFLASDDASFVNGIE
LFVDGGQAQI