Protein Info for AO356_22215 in Pseudomonas fluorescens FW300-N2C3

Annotation: sulfur relay protein TusE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03342: sulfur relay protein, TusE/DsrC/DsvC family
  • amino acids 5 to 111 (107 residues), 141.4 bits, E=6.4e-46
• PF04358: DsrC
  • amino acids 6 to 111 (106 residues), 124.1 bits, E=1.7e-40

Best Hits

Swiss-Prot: 52% identical to TUSE_HAEIN: Sulfurtransferase TusE homolog (tusE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K11179, tRNA 2-thiouridine synthesizing protein E [EC: 2.8.1.-] (inferred from 96% identity to pba:PSEBR_a3555)

MetaCyc: 46% identical to DsrC monomer (Allochromatium vinosum)
2.8.1.-

Predicted SEED Role

"tRNA 2-thiouridine synthesizing protein E (EC 2.8.1.-)" in subsystem Sulfate reduction-associated complexes (EC 2.8.1.-)

MetaCyc Pathways

• sulfur oxidation IV (intracellular sulfur) (3/7 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (5/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

See A0A0N9WZF9 at UniProt or InterPro

Protein Sequence (111 amino acids)

>AO356_22215 sulfur relay protein TusE (Pseudomonas fluorescens FW300-N2C3)
MNTLNVGDRAIALDKDGYLADLDDWSAEVATALASAEDIELSPEHWEILELLRGFYDEFQ
LSPATRPLIKYTALKLGADKGNSLHLNRLFKGTPAKLAAKLAGLPKPTNCL