Protein Info for AO356_22195 in Pseudomonas fluorescens FW300-N2C3

Annotation: serine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 TIGR00414: serine--tRNA ligase" amino acids 1 to 419 (419 residues), 567.2 bits, see alignment E=1.1e-174 PF02403: Seryl_tRNA_N" amino acids 1 to 107 (107 residues), 107.5 bits, see alignment E=4.3e-35 PF00587: tRNA-synt_2b" amino acids 218 to 402 (185 residues), 147.3 bits, see alignment E=5.4e-47

Best Hits

Swiss-Prot: 98% identical to SYS_PSEPF: Serine--tRNA ligase (serS) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01875, seryl-tRNA synthetase [EC: 6.1.1.11] (inferred from 99% identity to pba:PSEBR_a3559)

Predicted SEED Role

"Seryl-tRNA synthetase (EC 6.1.1.11)" in subsystem Glycine and Serine Utilization (EC 6.1.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H2Q7 at UniProt or InterPro

Protein Sequence (426 amino acids)

>AO356_22195 serine--tRNA ligase (Pseudomonas fluorescens FW300-N2C3)
MLDSKLLRSNLQDVADRLASRGFALDVARIEALEEQRKTVQTRTEALQAERNARSKSIGQ
AKQRGEDIAPLMADVERMAGELSAGKVELDAIQTELDSILLGIPNLPHESVPVGEDEDGN
VEVRRWGTPTTFDFPVQDHVALGEKFGWLDFETAAKLSGARFALLRGPIARLHRALAQFM
INLHVTEHGYEEAYTPYLVQAPALQGTGQLPKFEEDLFKISRDGEADLYLIPTAEVSLTN
IVAGEIVDAKQLPIKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVEPSKSMEA
LESLTANAEKVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREISSCSNCGD
FQARRMQARFRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPYMG
GIEVIG