Protein Info for AO356_22025 in Pseudomonas fluorescens FW300-N2C3

Annotation: NADH-quinone oxidoreductase subunit K

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00420: Oxidored_q2
  • amino acids 10 to 101 (92 residues), 91.1 bits, E=1.6e-30

Best Hits

Swiss-Prot: 100% identical to NUOK_PSEPF: NADH-quinone oxidoreductase subunit K (nuoK) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00340, NADH dehydrogenase I subunit K [EC: 1.6.5.3] (inferred from 91% identity to psb:Psyr_3206)

MetaCyc: 96% identical to NADH-quinone oxidoreductase subunit K (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain K (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (3/6 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

See Q8RQ72 at UniProt or InterPro

Protein Sequence (102 amino acids)

>AO356_22025 NADH-quinone oxidoreductase subunit K (Pseudomonas fluorescens FW300-N2C3)
MPAIPLEHGLAVAGILFCLGLVGLMVRRNILFVLMSLEVMMNASALAFIVAGARWAQPDG
QIMFILVISLAAAEASIGLAILLQLYRRFHTLDIDAASEMRG