Protein Info for AO356_21895 in Pseudomonas fluorescens FW300-N2C3

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 45 to 205 (161 residues), 88.8 bits, see alignment E=1.9e-29

Best Hits

Swiss-Prot: 37% identical to OPUCB_BACSU: Glycine betaine/carnitine/choline transport system permease protein OpuCB (opuCB) from Bacillus subtilis (strain 168)

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 60% identity to kpe:KPK_2010)

Predicted SEED Role

"Glycine betaine ABC transport system permease protein" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WB09 at UniProt or InterPro

Protein Sequence (227 amino acids)

>AO356_21895 ABC transporter permease (Pseudomonas fluorescens FW300-N2C3)
MNWIADVYLWFSLPEHWLGEDGILTRLAEHIYYVSLSLAIACAIALPLGVLMANYRKGAQ
VAIGLFNIGRALPSLGIVILAIMVIGYETSTVIIALVTLSIPPILTNTYVGIDQVDSSLK
HAAKSMGMRRWQMFIQLELPLAFPLIFSGFRSALVQLIATATIAAYAGFGGLGRFLIDGL
GRNDIPQIIGGALVVSALAIVSEWVCSMIETLMVRKWRAGNVELSAT