Protein Info for AO356_21675 in Pseudomonas fluorescens FW300-N2C3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details PF02535: Zip" amino acids 153 to 304 (152 residues), 101.7 bits, see alignment E=2.4e-33

Best Hits

KEGG orthology group: K07238, zinc transporter, ZIP family (inferred from 98% identity to pba:PSEBR_a1911)

Predicted SEED Role

"Metal transporter, ZIP family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W6T2 at UniProt or InterPro

Protein Sequence (309 amino acids)

>AO356_21675 hypothetical protein (Pseudomonas fluorescens FW300-N2C3)
MDQPTSRIRSPWRTWLNPVQENWLLGVTFWLGLALVAALLLYSGYNALVGANRQNLGYAV
LGGTSGFAATALGALMAVVLRDISSRTQDIMLGFAAGMMLAASSFSLILPGIEAAQVICG
NQLLAAFVVVVGLGLGVALMIGLDRFVPHEHELSGRRGPEVERINRVWLFVLAITLHNLP
EGMAIGVSFADGDFKVGLPLTTAIAIQDIPEGLAIAMALRVTGISTLRAALIAVGSGLME
PLGAVIGLGMSSGVAVAYPISLGLAAGAMIFVVSHEVIPETHRNGHETPATLGLMMGFAV
MMFLDTALG