Protein Info for AO356_20845 in Pseudomonas fluorescens FW300-N2C3

Annotation: alpha-L-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR02291: alpha-L-glutamate ligase homolog" amino acids 5 to 323 (319 residues), 576 bits, see alignment E=8.8e-178 PF14397: ATPgrasp_ST" amino acids 21 to 294 (274 residues), 326.5 bits, see alignment E=3.2e-101 PF08443: RimK" amino acids 239 to 278 (40 residues), 22.8 bits, see alignment 1.6e-08

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a3962)

Predicted SEED Role

"FIG002781: Alpha-L-glutamate ligase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WLB6 at UniProt or InterPro

Protein Sequence (328 amino acids)

>AO356_20845 alpha-L-glutamate ligase (Pseudomonas fluorescens FW300-N2C3)
MFGFWKTWKALEARGIMGINRRNADYVLKYNKRSLYPIVDDKIITKERAIAAGIHVPELY
GVISTEKEIDKLDEIIGGRTDFVIKPAQGAGGDGIIVIADRFEGRYRTVSGKIISHEEIE
HHVSSILTGLYSLGGHRDRALIEYRVTPDQIFKSISYEGVPDIRIIVLMGYPVMAMLRLP
TRQSGGKANLHQGAIGVGVDLATGLTLRGTWLNNIITKHPDTTNAVDGVQLPYWDGFMKL
AAGCYELCGLGYIGVDMVLDQEKGPLILELNARPGLNIQIANDCGLTLRTHAVEARLEEL
KERGVIETAEERVAFAQELFGHIPPVEG