Protein Info for AO356_20810 in Pseudomonas fluorescens FW300-N2C3

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00106: adh_short" amino acids 9 to 197 (189 residues), 188 bits, see alignment E=2.1e-59 PF08659: KR" amino acids 12 to 122 (111 residues), 41.7 bits, see alignment E=1.9e-14 PF13561: adh_short_C2" amino acids 18 to 246 (229 residues), 204.8 bits, see alignment E=2.3e-64

Best Hits

Swiss-Prot: 33% identical to KDUD_DICD3: 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase (kduD) from Dickeya dadantii (strain 3937)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 94% identity to pba:PSEBR_a3969)

MetaCyc: 33% identical to KduD (Dickeya dadantii 3937)
2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase. [EC: 1.1.1.127]

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.127

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H2M5 at UniProt or InterPro

Protein Sequence (248 amino acids)

>AO356_20810 oxidoreductase (Pseudomonas fluorescens FW300-N2C3)
MSTQALNGKVALIQGGSRGIGAAIVKRLAAEGAAVAFTYVSSGAKSEELQNSITAAGGKA
LAIKADSADADAVRNAVAATVEAFGRLDILVNNAGVLAMGPLDEFKLEDFDQTLAVNVRS
VFVATQAAARHMGEGGRVINIGSTNADRMPFVGGATYAMSKSALVGLTKGLARDLGPRGI
TVNNVQPGPVDTDMNPADSDFASSLLSLMAVGRYGNVDEIASFVAYLAGPEAGYITGASL
TIDGGFGA