Protein Info for AO356_20725 in Pseudomonas fluorescens FW300-N2C3

Annotation: diaminopimelate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 TIGR00652: diaminopimelate epimerase" amino acids 4 to 264 (261 residues), 193.6 bits, see alignment E=2.2e-61 PF01678: DAP_epimerase" amino acids 5 to 119 (115 residues), 53.4 bits, see alignment E=1.3e-18 amino acids 146 to 256 (111 residues), 81.2 bits, see alignment E=3.4e-27

Best Hits

Swiss-Prot: 48% identical to DAPF_RHOS4: Diaminopimelate epimerase (dapF) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 91% identity to pba:PSEBR_a3987)

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.7

Use Curated BLAST to search for 5.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H2M3 at UniProt or InterPro

Protein Sequence (267 amino acids)

>AO356_20725 diaminopimelate epimerase (Pseudomonas fluorescens FW300-N2C3)
MQLSFHKMHANGDDFVIVDSRNSASAVTSAMAHRMGDRNRGIGFNQLAVLLDCDDADARV
MFWNADGSALDVCGSATRGAADLLMREAHVTSLVLRTNRGLLTCERTPTGDISVDMGVPL
FGWSDIPLAQELDTAALPLADSPAACSMGNPHCTYFVDDLAGVDIATIGPTIETNALFPL
KTNVHFVQIIDRTHIRLRIWERGAGIALGSGSCSCGAVVNGIRRGLLDSTVEVECDGGSV
TVQWDGLGAVFLIGPVEASFSGTMSQG