Protein Info for AO356_20235 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): L-arabinolactonase (EC 3.1.1.15) / D-galactonolactonase (EC 3.1.1.25)
Rationale: Specifically important for: L-Arabinose; D-Galactose. The SEED prediction explains the phenotype on L-arabinose but not on D-galactose. L-arabinose and D-galactose are chemically similar and some dehydrogenases act on both substrates, so it is not surprising that a lactonase would hydrolase both of their products. The dehydrogenase is probably AO356_20240. (SEED_correct)
Original annotation: gluconolaconase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a4037)

Predicted SEED Role

"L-arabinolactonase (EC 3.1.1.15)" in subsystem L-Arabinose utilization (EC 3.1.1.15)

MetaCyc Pathways

L-arabinose degradation III (5/6 steps found)
D-galactose degradation II (2/2 steps found)
L-arabinose degradation V (4/6 steps found)
L-arabinose degradation IV (5/8 steps found)
superpathway of pentose and pentitol degradation (15/42 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.15 or 3.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WBN8 at UniProt or InterPro

Protein Sequence (291 amino acids)

>AO356_20235 L-arabinolactonase (EC 3.1.1.15) / D-galactonolactonase (EC 3.1.1.25)  (Pseudomonas fluorescens FW300-N2C3)
MKWTAVTEHRAKLGEGPFWDAPTQALYWVDIAGKQALRLIGANVEIWQMPEHVSAFIPTQ
SGDALVTLSSGVYRLDLDSPGLEPRLTLLCMADPQPGNRANEARCDPQGQLWLGTMQNNI
GAEGEDLPIEHRSGGLFRVGSDGRVLPLLRGLGIPNTLLWSPDGTTVYFGDSLDGTVYRH
FIYPEGNLAPAEVWFGPHPRGGPDGSAMDARGYIWNARWDGSCLLRLTPDGQVDRVIELP
VSRPTSCVFGGEDLKTLYITSAASPLGHPLDGAVLSMRVDVPGVACTRFAG