Protein Info for AO356_19955 in Pseudomonas fluorescens FW300-N2C3

Annotation: Flp pilus assembly protein CpaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR03177: Flp pilus assembly protein CpaB" amino acids 9 to 265 (257 residues), 215 bits, see alignment E=5.5e-68 PF08666: SAF" amino acids 42 to 101 (60 residues), 34 bits, see alignment E=3.5e-12 PF16976: RcpC" amino acids 109 to 213 (105 residues), 107.6 bits, see alignment E=3.7e-35

Best Hits

KEGG orthology group: K02279, pilus assembly protein CpaB (inferred from 97% identity to pba:PSEBR_a4092)

Predicted SEED Role

"Flp pilus assembly protein RcpC/CpaB" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W668 at UniProt or InterPro

Protein Sequence (271 amino acids)

>AO356_19955 Flp pilus assembly protein CpaB (Pseudomonas fluorescens FW300-N2C3)
MSSRTLPLIGVSLVMGLGAAWMADAWLSARLNASPDDHLRSVVVATVEIPFGQMVEAQQV
TTVRMPMDTIPDDAFDASEQAVGKIATFDILRGDIVRGARLSEHLGGSTLASLIAPDKRA
ISVRVDDVVGVGGFLLPGNRVDVLATKTTSAGSNSATSRTILENLRVLAVDQTAGTDKTQ
PVVVRAVTLEMSATEAEALVTAQTEGKLQLALRNPLNLEKKAVAVAPPAPAPVMAMAAAP
VPKPVVQRSAKPQGGAITLIRGVESSVINVR