Protein Info for AO356_19460 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): allantoinase (EC 3.5.2.5)
Rationale: Specifically important for: Inosine. This protein is similar to hpxB from Klebsiella, which is allantoinase, an step in the degradation of purines such as adenine or hypoxanthine (inosine is the nucleoside of hypoxanthine). See PMID:19060149
Original annotation: allantoinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03212: putative urate catabolism protein
  • amino acids 5 to 303 (299 residues), 544.1 bits, E=3.4e-168
• PF01522: Polysacc_deac_1
  • amino acids 75 to 162 (88 residues), 63.8 bits, E=7.8e-22

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a4184)

Predicted SEED Role

"Uricase (urate oxidase) (EC 1.7.3.3)" (EC 1.7.3.3)

MetaCyc Pathways

• superpathway of purines degradation in plants (15/18 steps found)
• superpathway of allantoin degradation in yeast (6/6 steps found)
• ureide biosynthesis (6/7 steps found)
• allantoin degradation to glyoxylate I (3/3 steps found)
• allantoin degradation to ureidoglycolate I (urea producing) (2/2 steps found)
• urate conversion to allantoin I (2/3 steps found)
• superpathway of allantoin degradation in plants (5/8 steps found)
• allantoin degradation to glyoxylate II (2/5 steps found)
• allantoin degradation to glyoxylate III (2/5 steps found)
• allantoin degradation to ureidoglycolate II (ammonia producing) (1/4 steps found)
• allantoin degradation IV (anaerobic) (3/9 steps found)

KEGG Metabolic Maps

• Caffeine metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.7.3.3

Use Curated BLAST to search for 1.7.3.3 or 3.5.2.5

Sequence Analysis Tools

See A0A0N9W5Z8 at UniProt or InterPro

Protein Sequence (313 amino acids)

>AO356_19460 allantoinase (EC 3.5.2.5) (Pseudomonas fluorescens FW300-N2C3)
VSADYPRDLIGYGNNPPHPQWPGNARIALSFVLNYEEGGERNVLHGDKESEAFLSEMVAA
QPLQGERNMSMESLYEYGSRAGVWRVLKLFKAFDIPLTIFAVAMAAQRHPDVIRAMVAAG
HEICSHGYRWIDYQYMDEAQEREHMLEAIRILTEITGERPLGWYTGRTGPNTRRLVMEEG
GFLYDSDTYDDDLPYWEPNTPNGKPHLVIPYTLDTNDMRFTQVQGFNKGDDFFQYLKDAF
DVLYAEGAEAPKMLSIGLHCRLIGRPARLASLKRFLEYVKGHEHVWFSRRVDIARHWQQA
HPYQGASNPGASK