Protein Info for AO356_18945 in Pseudomonas fluorescens FW300-N2C3

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details PF00672: HAMP" amino acids 253 to 304 (52 residues), 43.4 bits, see alignment 5.1e-15 PF00512: HisKA" amino acids 309 to 373 (65 residues), 50.8 bits, see alignment E=2e-17 PF02518: HATPase_c" amino acids 424 to 531 (108 residues), 83 bits, see alignment E=3.3e-27

Best Hits

KEGG orthology group: K07639, two-component system, OmpR family, sensor histidine kinase RstB [EC: 2.7.13.3] (inferred from 98% identity to pba:PSEBR_a4281)

Predicted SEED Role

"Sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H2I2 at UniProt or InterPro

Protein Sequence (536 amino acids)

>AO356_18945 histidine kinase (Pseudomonas fluorescens FW300-N2C3)
VNSIFLRIYGGMCAALVLVAVLGVLALHLLNQTRGEQYRERLAHGTFSLMADNLRPMDDT
ERRRALAVWERLLGIPLALQTFSQTDLDLGQRTRVLRGQALVEQTGPHAAKVYRLVNDTE
QLMLVGEVQQISEQLARATIYLLADELVRYPVAEQPKRLAQLEQEKGFGFDLRLMTAEQA
DMDEDQRRRVSEGDTVMALGKGGDSIRVFAGMVGTPWVLEIGPLYQMNPYPPQWLVLIAA
LGLSLIGLIVYLLVRQLERRLRGLESAATQIAQGSLETRVPARGADSVGRLAAAFNGMAE
HLQQLLAIQRELVRAVSHELRTPVARLRFGLEMLGSATTPQARDKYLAGMDHDIEDLDRL
VDEMLTYARLEQGSPALNFQRVDLDALVNQVIDELGPLRAGITVERGLCLSAADCDGAWV
EAEPRFLHRALQNLVGNAMRHAHSKVTVSYQVGQLRCRVDVEDDGPGVPEAAWERIFKPF
LRLDDSRARASGGHGLGLSIVRRIIHWHDGRALIGKSKSLGGACFSLSWPRHQDRS