Protein Info for AO356_18715 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): L-Arginine ABC transporter, ATPase component
Rationale: Important for utiliizing L-arginine. Detrimental on L-lysine which might indicate that it leaks lysine. (SEED_correct)
Original annotation: amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 19 to 178 (160 residues), 124.7 bits, E=4.4e-40

Best Hits

Swiss-Prot: 89% identical to AOTP_PSEAE: Arginine/ornithine transport ATP-binding protein AotP (aotP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a4321)

Predicted SEED Role

"Arginine/ornithine ABC transporter, ATP-binding protein AotP" in subsystem Arginine and Ornithine Degradation

Sequence Analysis Tools

See A0A0N9X1K7 at UniProt or InterPro

Protein Sequence (254 amino acids)

>AO356_18715 L-Arginine ABC transporter, ATPase component (Pseudomonas fluorescens FW300-N2C3)
MYKLEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKI
LLNNEELKLVAGKDGAMKAADPKQLQRMRSRLSMVFQHFNLWSHMTALENIMEAPVHVLG
VAKAEAREKAEHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSAL
DPELVGDVLKVMQALAVEGRTMVVVTHEMGFAREVSNQLVFLHKGIVEESGNPREVLVNP
QSERLQQFLSGSLK