Protein Info for AO356_18710 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): L-Arginine ABC transporter, permease component 1
Rationale: Specific phenotypes on L-Arginine; L-Arginine. (SEED_correct)
Original annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 16 to 43 (28 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 117 (106 residues), 75.3 bits, see alignment E=2.2e-25 PF00528: BPD_transp_1" amino acids 31 to 223 (193 residues), 66.1 bits, see alignment E=1.8e-22

Best Hits

Swiss-Prot: 49% identical to OCCM_RHIRD: Octopine transport system permease protein OccM (occM) from Rhizobium radiobacter

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a4322)

Predicted SEED Role

"Arginine/ornithine ABC transporter, permease protein AotM" in subsystem Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WA12 at UniProt or InterPro

Protein Sequence (232 amino acids)

>AO356_18710 L-Arginine ABC transporter, permease component 1 (Pseudomonas fluorescens FW300-N2C3)
MIFDYNVIYEALPLYFSGLLTTLKLLALSLFFGLLAALPLGLMRVSKQPIVNMTAWLYTY
VIRGTPMLVQLFLIYYGLAQFAIVRESFLWPWLSSATFCACLAFAINTSAYTAEIIAGSL
RATPNGEIEAAKAMGMSRYKLYRRILLPSALRRALPQYSNEVIMMLQTTSLASIVTLIDI
TGAARTVNAQYYLPFEAYITAGAFYLCLTFILVRLFKLAERRWLGYLAPRKH