Protein Info for AO356_18700 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): L-Arginine ABC transporter, periplasmic substrate-binding component
Rationale: Specific phenotype on L-Arginine. (SEED_correct)
Original annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01096: lysine-arginine-ornithine-binding periplasmic protein" amino acids 3 to 250 (248 residues), 284 bits, see alignment E=5.2e-89 PF00497: SBP_bac_3" amino acids 26 to 251 (226 residues), 205.7 bits, see alignment E=6.6e-65 PF10613: Lig_chan-Glu_bd" amino acids 66 to 118 (53 residues), 32.9 bits, see alignment E=6.2e-12

Best Hits

Swiss-Prot: 44% identical to ARGT_SALTY: Lysine/arginine/ornithine-binding periplasmic protein (argT) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a4324)

Predicted SEED Role

"Arginine/ornithine ABC transporter, periplasmic arginine/ornithine binding protein" in subsystem Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WZF1 at UniProt or InterPro

Protein Sequence (257 amino acids)

>AO356_18700 L-Arginine ABC transporter, periplasmic substrate-binding component (Pseudomonas fluorescens FW300-N2C3)
MKKLVLLGALALSVLSLPTFADEKPLKIGIEAAYPPFASKAPDGSIVGFDYDIGNALCEE
MKVKCVWVEQEFDGLIPALKVRKIDAILSSMSITEDRKKSVDFTNKYYNTPARLVMKAGT
QVSDNLAELKGKNIGVQRGSIHERFAREVLAPLGAEIKPYGSQNEIYLDVAAGRLDGTVA
DATLLDDGFLKTDAGKGFAFVGPAFTDEKYFGDGIGIAVRKGDALKDKINGAITALRENG
KYKQIQDKYFAFDIYGK