Protein Info for AO356_18650 in Pseudomonas fluorescens FW300-N2C3

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 45 to 68 (24 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details PF01810: LysE" amino acids 19 to 198 (180 residues), 63.2 bits, see alignment E=1.2e-21

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a4329)

Predicted SEED Role

"putative threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WA06 at UniProt or InterPro

Protein Sequence (206 amino acids)

>AO356_18650 lysine transporter LysE (Pseudomonas fluorescens FW300-N2C3)
MQEIFSINWLLWLSTMVPLTLSAGPGNLMVATSGAQSGVRRSVRFIVGLDITYFLIAVLV
GLGLYHTLMNNPTLVWALQVVGSFYILWLGVRMLRRPLKAPTDKAMHLQFRDGIVIQLGN
VQGIVMLLVMFSTFMPSGETSSTVVLILSAALISLNFFSHVIWVSMGSTVQKLIQSRPKL
LMFQNAAFGLMLIAVAVWIFLRISPL