Protein Info for AO356_18225 in Pseudomonas fluorescens FW300-N2C3

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 26 to 51 (26 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 158 to 165 (8 residues), see Phobius details amino acids 179 to 195 (17 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 25 to 131 (107 residues), 63.7 bits, see alignment E=9e-22 PF00528: BPD_transp_1" amino acids 44 to 238 (195 residues), 99.8 bits, see alignment E=8.2e-33

Best Hits

Swiss-Prot: 53% identical to GLTJ_ECOLI: Glutamate/aspartate import permease protein GltJ (gltJ) from Escherichia coli (strain K12)

KEGG orthology group: K10003, glutamate/aspartate transport system permease protein (inferred from 98% identity to pba:PSEBR_a4409)

MetaCyc: 53% identical to glutamate/aspartate ABC transporter membrane subunit GltJ (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W9W3 at UniProt or InterPro

Protein Sequence (248 amino acids)

>AO356_18225 amino acid ABC transporter permease (Pseudomonas fluorescens FW300-N2C3)
MNYNWDWGVFFKSTGVGSEIYLDWYLAGLGWTIAIAVVAWIIALLLGSLLGVMRTVPNRL
VSGIATCYVELFRNVPLLVQLFIWYFLVPDLLPADMQEWYKQDLNPTTSAYLSVVVCLGL
FTAARVCEQVRTGIQALPRGQESAARAMGFKLPQIYWNVLLPQAYRIIIPPLTSEFLNVF
KNSSVASLIGLMELLAQTKQTAEFSANLFEAFTLATLIYFTLNMSLMLLMRMVEKKVAVP
GLISVGGK