Protein Info for AO356_18045 in Pseudomonas fluorescens FW300-N2C3

Annotation: protein TolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details TIGR02794: protein TolA" amino acids 15 to 354 (340 residues), 205.9 bits, see alignment E=1.1e-64 PF13103: TonB_2" amino acids 266 to 335 (70 residues), 42.6 bits, see alignment E=5.2e-15 TIGR01352: TonB family C-terminal domain" amino acids 281 to 352 (72 residues), 47.2 bits, see alignment E=2.3e-16 PF03544: TonB_C" amino acids 290 to 340 (51 residues), 28.3 bits, see alignment 2.1e-10

Best Hits

Swiss-Prot: 64% identical to TOLA_PSEAE: Tol-Pal system protein TolA (tolA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03646, colicin import membrane protein (inferred from 100% identity to pba:PSEBR_a4436)

Predicted SEED Role

"TolA protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W9U3 at UniProt or InterPro

Protein Sequence (359 amino acids)

>AO356_18045 protein TolA (Pseudomonas fluorescens FW300-N2C3)
MQQQREPSASESYFWPSVLAIGLHVLVFGMLFVSFAMTPELPPAKPIVQATLYQLKSKSQ
ATTQTNQKLAGEAKKSAARQTEVEQMEQKKVEQEAIKAAEQKKEEAAQKAEEAKKADEAK
KADEAKKADEAKKADEAKKTAEAKKAEEKQLADIAKKKAEEEAKKAAEEEAKKAAAEEAK
KKIVEDAKKKAAEDAKKKAEAEEAKKKVAEDAKKKAAADAAKKKAQDAARKSAEDKKAQA
LADLLSDTPERQQALADEQGDEVAGSYDDLIRARAAEGWARPPSARKGMTVVLQIGMLPD
GTVTSVSVAKSSGDGPFDASAVAAVKNIGRLTEMQGMKPSDFAPYRSFKMTFTPEDLAL