Protein Info for AO356_17535 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): N-acetylglucosamine-specific PTS system, IIBC components (nagE)
Rationale: Specific phenotype on NAG as a carbon source. Not sure why SEED think s this includes the IIA component. (KEGG_correct)
Original annotation: PTS N-acetyl-D-glucosamine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 114 (17 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 163 to 186 (24 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 262 to 279 (18 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details TIGR01998: PTS system, N-acetylglucosamine-specific IIBC component" amino acids 9 to 457 (449 residues), 573.7 bits, see alignment E=2.9e-176 PF02378: PTS_EIIC" amino acids 14 to 303 (290 residues), 244.9 bits, see alignment E=1.2e-76 TIGR00826: PTS system, glucose-like IIB component" amino acids 360 to 445 (86 residues), 56.4 bits, see alignment E=2.9e-19 PF00367: PTS_EIIB" amino acids 388 to 419 (32 residues), 37.3 bits, see alignment (E = 1.5e-13)

Best Hits

KEGG orthology group: K02803, PTS system, N-acetylglucosamine-specific IIB component [EC: 2.7.1.69] K02804, PTS system, N-acetylglucosamine-specific IIC component (inferred from 90% identity to pba:PSEBR_a4546)

Predicted SEED Role

"PTS system, N-acetylglucosamine-specific IIA component (EC 2.7.1.69) / PTS system, N-acetylglucosamine-specific IIB component (EC 2.7.1.69) / PTS system, N-acetylglucosamine-specific IIC component (EC 2.7.1.69)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H2E9 at UniProt or InterPro

Protein Sequence (571 amino acids)

>AO356_17535 N-acetylglucosamine-specific PTS system, IIBC components (nagE) (Pseudomonas fluorescens FW300-N2C3)
MYQHFIEGLQRLGRALMLPIAILPIAGLLLRLGDTDLLDIAIIHDAGQAIFANLAMIFAI
GIAVGFARDNNGTAGLAGAIGYLVMIATLKVLDASINMGMLAGIISGLLAGALYNRFKDI
KLPEYLAFFGGRRFVPIVTGFSAVGLGVVFGLIWPPIQQGINGFGALLMESGSFGAFVFG
VFNRLLIVTGLHHILNNMAWFIFGSFTDPATGAVVTGDLSRYFAGDPKGGQFMTGMFPVM
LFGLPAACLAMYRNALPQRRKVMGGILLSMALTSFLTGVTEPIEFAFMFLAPLLFLVHAL
LTGVSMAVTNLLGIHLGFTFSGGFIDMVLGWGKSTNGWLVVPVGLAYAAIYYLVFDFCIR
RFDLKTPGREEVPAGDKPAIAENQRAAAYIQALGGADNLITIGACTTRLRLDMVDRNKAS
DAQLKALGAMAVVRPGNGGSLQVVVGPMADSIADEIRLAVPSSLRPVTAPVPNAPAPTTP
AALSSTEAQQWLDALGGQDNVLQLECVATSRLRVRLADDKGLSESRLKGLGCQGMSSLED
GVWHLLLGEKAPRLWQALDGLAHGRKVDAGA