Protein Info for AO356_17480 in Pseudomonas fluorescens FW300-N2C3

Annotation: LPS export ABC transporter permease LptG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details amino acids 299 to 316 (18 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details TIGR04408: LPS export ABC transporter permease LptG" amino acids 4 to 351 (348 residues), 430.9 bits, see alignment E=1.3e-133 PF03739: LptF_LptG" amino acids 6 to 351 (346 residues), 268.5 bits, see alignment E=4.3e-84

Best Hits

KEGG orthology group: K11720, lipopolysaccharide export system permease protein (inferred from 99% identity to pba:PSEBR_a4557)

Predicted SEED Role

"FIG000906: Predicted Permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WA65 at UniProt or InterPro

Protein Sequence (353 amino acids)

>AO356_17480 LPS export ABC transporter permease LptG (Pseudomonas fluorescens FW300-N2C3)
VVKLDRYIGSSVFMAILAVLGIILGLATLFAFIDEMSDVSDTYTLTDVASYVLLTAPRRL
YDMLPMAALIGCLIGLGSLASNSELTIMRAAGVSIGRIVWAVMKPMLVLMLVGVLIGEYI
APATENTAQANRSLAQGGGDAQSAKHGLWHRQGDEFIHINSVQPNGILYGVTRYRFDDQR
HMLSSSFAKRANFAEDHWQLSDVTTTLFHDKRTEVVAAPQERWDVSISPQLLSTVVMAPE
SLSITGLWGYIHYLADQGLNNGRYWLAFWVKVLQPLVTAALVLMAISFIFGPLRSVTLGQ
RVFTGVLVGFTFRIAQDLLGPSSLVFGFSPLFAVLVPAGVCALAGLWLLRRAG