Protein Info for AO356_17475 in Pseudomonas fluorescens FW300-N2C3

Annotation: LPS export ABC transporter permease LptF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 34 to 34 (1 residues), see Phobius details amino acids 56 to 56 (1 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 336 to 354 (19 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 2 to 354 (353 residues), 396.6 bits, see alignment E=3.6e-123 PF03739: LptF_LptG" amino acids 5 to 353 (349 residues), 243.2 bits, see alignment E=2.1e-76

Best Hits

KEGG orthology group: K07091, lipopolysaccharide export system permease protein (inferred from 98% identity to pba:PSEBR_a4558)

Predicted SEED Role

"FIG000988: Predicted permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WXC8 at UniProt or InterPro

Protein Sequence (373 amino acids)

>AO356_17475 LPS export ABC transporter permease LptF (Pseudomonas fluorescens FW300-N2C3)
LIVFRYLSREVLLTLSAVSAVLLVIIMSGRFIKYLAQAASGALDPGSLFLIMGFRLPGFL
QLILPLGLFLGILLAYGRLYLDSEMTVLSATGMSQQRLFRMTLFPATLVALVVAWLSLSL
SPQGANQFQLLINQQDAMTEFDTLVPGRFQALRDGTRVTYTEQLSDDRIDLGGVFITQKN
LSSDSKKDRGISVLVAEKGRQEINPDGNRYLILHNGYRYDGKPGQADYRAIKYDTYGVLL
PKPEVSDEVTDRDAMPTASLLGNKDIRARTELQWRLSLPLLVFIVTLMAVPLSRVNPRQG
RFLKLLPAILLYMAYLTILISARGALEKGKIPPALGLWWVHGIFLAIGLGLLYWEPLRLK
LASRRSALEVARG