Protein Info for AO356_17135 in Pseudomonas fluorescens FW300-N2C3

Annotation: UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 transmembrane" amino acids 297 to 313 (17 residues), see Phobius details TIGR01085: UDP-N-acetylmuramyl-tripeptide synthetase" amino acids 17 to 479 (463 residues), 523.5 bits, see alignment E=2.7e-161 PF01225: Mur_ligase" amino acids 18 to 94 (77 residues), 47.4 bits, see alignment E=3e-16 PF08245: Mur_ligase_M" amino acids 106 to 306 (201 residues), 195 bits, see alignment E=2.1e-61 PF02875: Mur_ligase_C" amino acids 328 to 410 (83 residues), 83.7 bits, see alignment E=1.4e-27

Best Hits

Swiss-Prot: 84% identical to MURE_PSESM: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (murE) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K01928, UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [EC: 6.3.2.13] (inferred from 98% identity to pba:PSEBR_a4626)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC 6.3.2.13)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WYS7 at UniProt or InterPro

Protein Sequence (487 amino acids)

>AO356_17135 UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase (Pseudomonas fluorescens FW300-N2C3)
MSLSLNKIFAHAGHDLLIRELALDSRNVRAGDLFLAVPGARVDGRDHIADALKRGAAAVA
YEVQGATVLPITDVPLIPVKGLAAQLSDIAGRFYGDPSRHLNLVGVTGTNGKTSVTQLVA
QALDLLGQHCGIVGTLGNGFHGALESGLHTTPNPIAVQATLADLKKAGAKAVAMEVSSHG
LDQGRVTALAFDVAVLTNLSRDHLDYHGTMQAYGEAKAKLFAWNDLKCRVINLDDEFGRQ
LAADKRESRLITYSLEDTSAYLYIRQAQFNDEGVRATLVTPQGEHHLRSTLLGRFNLSNV
LAAIGALLGLDYALDEILKVLPKLEGPAGRMQRLGGGAQPLVVVDYAHTPDALEKVLTAL
RPHAKGKLLCLFGCGGDRDRGKRPLMAEVVERLADGVLVTDDNPRSEDPLRIFDDIRAGF
TAVDKVNFVAGRGQAIAQLIASASADDVIVLAGKGHEDYQEINGERHAFSDLVEADHALT
AWEVAHA