Protein Info for AO356_17115 in Pseudomonas fluorescens FW300-N2C3

Annotation: division/cell wall cluster transcriptional repressor MraZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF02381: MraZ" amino acids 2 to 75 (74 residues), 53.1 bits, see alignment E=1.3e-18 amino acids 78 to 132 (55 residues), 54.9 bits, see alignment E=3.5e-19 TIGR00242: division/cell wall cluster transcriptional repressor MraZ" amino acids 2 to 148 (147 residues), 150.2 bits, see alignment E=1.9e-48

Best Hits

Swiss-Prot: 99% identical to MRAZ_PSEF5: Transcriptional regulator MraZ (mraZ) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03925, MraZ protein (inferred from 98% identity to pfo:Pfl01_4682)

Predicted SEED Role

"Cell division protein MraZ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WX75 at UniProt or InterPro

Protein Sequence (151 amino acids)

>AO356_17115 division/cell wall cluster transcriptional repressor MraZ (Pseudomonas fluorescens FW300-N2C3)
VFRGANAISLDAKGRLAMPSRYRDELVSRSSGQLIVTIDAVDPCLCVYPLDEWELIETKL
RALPSLREENRRLQRLLIGNAVDLELDGSGRFLVPPRLREYAKLDKRAMLVGQLNKFQLW
DEDAWNAVSAADLAAIQQPGAMPDELRDLIL