Protein Info for AO356_16705 in Pseudomonas fluorescens FW300-N2C3

Annotation: glycoside hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 PF13439: Glyco_transf_4" amino acids 26 to 192 (167 residues), 102.7 bits, see alignment E=7.1e-33 PF13579: Glyco_trans_4_4" amino acids 27 to 183 (157 residues), 62.5 bits, see alignment E=1.8e-20 PF00534: Glycos_transf_1" amino acids 203 to 364 (162 residues), 100.3 bits, see alignment E=2.9e-32 PF20706: GT4-conflict" amino acids 210 to 376 (167 residues), 32 bits, see alignment E=2.1e-11 PF13692: Glyco_trans_1_4" amino acids 216 to 350 (135 residues), 96.6 bits, see alignment E=4.9e-31

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a4719)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WJJ6 at UniProt or InterPro

Protein Sequence (399 amino acids)

>AO356_16705 glycoside hydrolase (Pseudomonas fluorescens FW300-N2C3)
MAPVDTGVMTTPLHITLITETFPPEINGVANTLGRLYDGLRARGHQVELIRPRQADDLRQ
ASDEQLLLCRGWPLPGYPGLQWGQASMHKLLRRWKRHRPDVLYIATEGPLGLSALRAARR
LGISVVSGFHTNFQQYTQQYGLGLLSRVLTHYLRWFHNRSSLTLVPSLSQRLELERRHFE
RVALLSRGVDSQLFHPVKRSSSLREAWGLGDDDIAVLHVGRLAPEKNLGLLKRSFETLCS
AFAGRRMKLVIVGDGPQRSELEQELPEAIFCGSQRGEALASHYASGDVFVFPSLTETFGN
VVLEALASGLGVVAYDQAAAAQHIRHGYNGVLAMPGDEEAFCDAARWLLEERETLRCVRL
NARQHASRQGWAAVIEQFEAQLRGVCQVESSLPQAVSQR