Protein Info for AO356_16425 in Pseudomonas fluorescens FW300-N2C3

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 65 to 83 (19 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 243 to 270 (28 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details PF01032: FecCD" amino acids 15 to 332 (318 residues), 295.3 bits, see alignment E=4.9e-92 PF00950: ABC-3" amino acids 110 to 307 (198 residues), 41.9 bits, see alignment E=9.1e-15

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 89% identity to pfs:PFLU4220)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X084 at UniProt or InterPro

Protein Sequence (338 amino acids)

>AO356_16425 ABC transporter permease (Pseudomonas fluorescens FW300-N2C3)
MIPTLIRTLLALAALLLAVIAGVAIGETSIEPSVVFQVLANKLWAAGYALDPIDEGIVWN
YRLTRALVAAACGAGLATCGVILQSLLRNPLADPYLLGISAGASTGAVLVALLGIGAGLI
SLSVGAFAGAVAAFAVVVLLARASRSPAGTGQIILAGIAGSQLFNALTAFLITKSASSEQ
ARGIMFWLLGNLSGVRWPSVWLSVPVALIGLAVCLWHRRALDAFTFGADSAASLGIPVRR
VQFLLISCAALVTAVMVSIVGSIGFVGLVIPHAVRLLLGTRHARLLPASALGGAVFLIAA
DVFSRTLIKGQVIPVGVITALVGAPVFALILIGRRNAR